Flavanols, flavonols and dihydroflavonols

Wine Chemistry and Biochemistry

Volumn , Issue , 2009, Pages 463-507

  Terrier, Nancy ^a   Poncet Legrand, Céline ^a   Cheynier, Véronique ^a  

^a SPO   (France)

Author keywords

[No Author keywords available]

Indexed keywords

EID: 84855561492     PISSN: None     EISSN: None     Source Type: Book    
DOI: 10.1007/978-0-387-74118-5_22     Document Type: Chapter

References (215)

1. Abrahams, S., Lee, E., Walker, A. R., Tanner, G. J., Larkin, P. J., & Ashton, A. R. (2003). TheArabidopsisTDS4geneencodesleucoanthocyanidindioxygenase(LDOX) andisessentialforproanthocyanidinsynthesisandvacuoledevelopment.PlantJ.,35, 624-636.
2. Alcalde-Eon, C., Escribano-Bailon, M., Santos-Buelga, C., & Rivas-Gonzalo, J. (2006). Changes in thedetailedpigmentcompositionofredwineduringmaturityandageing- Acomprehensivestudy.Anal.Chim.Acta,563,238-254.
3. Alcalde-Eon, C., Escribano-Bailon, M., Santos-Buelga, C., & Rivas-Gonzalo, J. (2007). Identification of dimeric anthocyanins and new oligomeric pigments in red wine by means of HPLCDAD-ESI/MSn. J. Mass Spectrom., 42, 735-748.
4. Alonso, E., Estrella, I., & Revilla, E. (1986). Presence of quercetin-3-O-glucuronoside in spanish table wines. J. Sci. Food Agric., 37, 1118-1120.
5. Atanasova, V., Fulcrand, H., Le Guerneve,C.,Cheynier,V.,&Moutounet,M. (2002a).Structureofanewdimericacetaldehydemalvidin3- glucosidecondensationproduct.TetrahedronLett.43,6151-6153.
6. Atanasova, V., Fulcrand, H., Le Guernevé, C., Dangles, O., & Cheynier, V. (2002b). First evidence of acetaldehyde-induced anthocyanin polymerisation. Polyphenol Communications 2002. Marrakech,pp. 417-418.
7. Baderschneider, B., & Winterhalter, P. (2001). Isolation and characterizationofnovelbenzoates,cinnamates,flavonoids, andlignansfromRieslingwineandscreeningforantioxidantactivity.J.Agric.FoodChem., 49,2788-2798.
8. Bae,Y.S.,Foo,L.Y.,&Karchesy,J.J.(1994). GPCofnaturalprocyanidinoligomersandpolymers.Holzforschung,48,4-6.
9. Baranowski,J.D.,&Nagel,C.W.(1983).Kineticofmalvidin-3- glucosidecondensationinwinemodelsystems.J.FoodSci.,48,419-421.
10. Bautista-Ortin, A. B., Martinez-Cutillas, A., Ros-Garcia, J. M., Lopez-Roca, J. M., & Gomez- Plaza, E. (2005). Improving colour extractionandstabilityinredwines:theuseofmacerationenzymesandenologicaltannins. Int.J.FoodSci.Technol.,40,867-878.
11. Baxter, N. J., Lilley, T. H., Haslam, E., & Williamson, M.P.(1997a).Multipleinteractionsbetweenpolyphenolsandasalivaryproline- richproteinrepeatresultincomplexationandprecipitation.Biochemistry,36,5566-5577.
12. Baxter, N. J., Lilley, T. H., Haslam, E., & Williamson, M. P. (1997b). Multiple interactions between polyphenols and a salivary proline-rich protein repeat results in complexation and precipitation. Biochemistry, 36, 5566-5577.
13. Berg, H. W.(1959). Theeffectsofseveralfungalpecticenzymepreparationsongrapemustsandwines.Am.J.Enol. Vitic.,10,130-134.
14. Betes-Saura, C., Andres-Lacueva, C., & Lamuela-Raventos, R. M. (1996). Phenolics in white free run juices and wines from Penedes by High-performance liquid chromatography: Changes during vinification. J. Agric. Food Chem., 44, 3040-3046.
15. Bishop, P. B., &Nagel,C.W.(1984). Characterizationofthecondensationproductofmalvidin3,5-diglucosideandcatechin.J. Agric.FoodChem.,32,1022-1026.
16. Bogs, J., Downey, M., Harvey, J., Ashton, A., Tanner, G., & Robinson, S. (2005). Proanthocyanidin synthesis and expression of genes encoding leuanthocyanidin reductase and anthocyanidin reductase in developing grape berries and grapevine leaves. Plant Physiol., 139, 652-663.
17. Boido, E., Alcalde-Eon, C., Carrau, F., Dellacassa, E., & Rivas-Gonzalo, J. C. (2006). Aging effect on the pigment composition and color of Vitis vinifera L. Cv. Tannat wines. Contribution of the main pigment families to wine color. J. Agric. Food Chem., 54, 6692-6704.
18. Boissier, B., Lutin, F., Moutounet, M., & Vernhet, A. (2008). Particles deposition during the crossflow microfiltration of red wines -incidence of the hydrodynamic conditions and of the yeast to fines ratio. Chem. Engin. Process., 47(3) 276-286
19. Boukharta, M., Girardin, M., & Metche, M. (1988). Procyanidines galloylées du sarment devigne(Vitisvinifera) separationetidentificationparchromatographieliquidehauteperformanceetchromato graphieenphasegazeuse.J.Chromatogr.,455,406-409.
20. Boulton, D., Walle,U.,&Walle,T.(1998). Extensivebindingofthebioflavonoidquercetintohumanplasmaproteins.J. PharmacyPharmacol.,50,243-249.
21. Boulton, R. (2001). The copigmentationofanthocyaninsanditsroleinthecolorofredwine:acriticalreview.Am.J. Enol.Vitic.,52,67-87.
22. Bourzeix, M., Weyland, D., & Heredia, N. (1986). Etude des catéchines et des procyanidols de la grappe de raisin, du vin et d'autres dérivés de la vigne. Bull. OIV, 669-670, 1171-1253.
23. Bradshaw, M. P., Cheynier, V., Scollary, G. R., & Prenzler, P. D. (2003). Defining the ascorbic acid crossover from anti-oxidant to pro-oxidant in a model wine matrix containing (+)-catechin. J. Agric. Food Chem., 51, 4126-4132.
24. Brouillard, R., & Dangles, O. (1993). Flavonoids and flower colour in Harborne, J. B. (Ed), The flavonoids. Advances in research since 1986, Chapman and Hall, pp. 565-588.
25. Brouillard, R., & Dangles, O. (1994). Anthocyanin molecular interactions : the first step in the formation of new pigments during wine aging. Food Chem., 51, 365-371.
26. Calderon, P., VanBuren, J., & Robinson, W. (1968). Factors influencing the formation of precipitates and hazes by gelatin and condensed and hydrolyzable tannins. J. Agric. Food Chem., 16, 479-482.
27. Canals, R., Llaudy,M.,Valls, J., Canals, J., & Zamora, F. (2005). Influence of ethanol concentration on the extraction of color and phenolic compounds from the skins and seeds of Tempranillo grapes at different stages of ripening. J. Agric. Food Chem., 53, 4019-4025.
28. Cantos, E., Espin, J., & Tomas-Barberan, F. (2002). Varietal differences among the polyphenol profiles of seven table grape cultivars studied by LC-DAD-MS-MS. J. Agric. Food Chem., 50, 5691-5696.
29. Castellarin, S., Di Gaspero, G., Marconi, R., Nonis, A., Peterlunger, E., Paillard, S., Adam-Blondon, A., & Testolin, R. (2006). Colour variation in red grapevines (Vitis vinifera L.): genomic organisation, expression of flavonoid 3'-hydroxylase, flavonoid3',5'- hydroxylasegenesandrelatedmetaboliteprofilingofredcyanidin-/ bluedelphinidinbasedanthocyaninsinberryskin.BMCGenomics,7,12.
30. Chamkha, M., Cathala, B., Cheynier, V., & Douillard, R. (2003). Phenolic composition of champagnes from Chardonnay and Pinot Noir vintages. J. Agric. Food Chem., 51, 3179-3184.
31. Charlton, A. J., Baxter, N. J., Lilley, T. H., Haslam, E., McDonald, C. J., & Williamson, M. P. (1996). Tannin interactions with a full-length human salivary proline-rich protein display a stronger affinity than with proline-rich repeats. FEBS Lett., 382, 289-292.
32. Charlton, A., Baxter, N. J., Khan, M. L., Moir, A. J. G., Haslam, E., Davis, A. P., & Williamson, M. P. (2002a). Polyphenol/peptide binding and precipitation. J. Agric. Food Chem., 50,1593-1601.
33. Charlton, A. J., Haslam, E., & Williamson, M. P.(2002b). Multipleconformationsoftheprolinerich-protein/ epigallocatechingallatecomplexdeterminedbytime-averagednuclearoverhausereffects. J.Am.Chem.Soc.,124,9899-9905.
34. Cheynier, V., & Ricardo Da Silva, J.M. (1991). Oxidation of grape procyanidins in model solutions containing trans-caffeoyl tartaric acid and grape polyphenoloxidase. J. Agric. Food Chem., 39,1047-1049.
35. Cheynier, V., & Rigaud, J. (1986). HPLC separation and characterization of flavonols in the skins of Vitis vinifera var. Cinsault. Am. J. Enol. Vitic., 37, 248-252.
36. Cheynier, V., & Van Hulst, M. W. (1988). Oxidation of trans-caftaric acid and 2-S-glutathionyl caftaric acid in model solutions. J. Agric. Food Chem., 36, 10-15.
37. Cheynier, V., Osse, C., & Rigaud, J. (1988). Oxidation of grape juice phenolic compounds in model solutions. J. Food Sci., 53, 1729-1732.
38. Cheynier, V., Basire, N., & Rigaud, J. (1989a). Mechanism of trans-caffeoyl tartaric acid and catechin oxidation in model solutions containing grape polyphenoloxidase. J. Agric. Food Chem.,37, 1069-1071.
39. Cheynier, V., Rigaud, J., Souquet, J. M., Barillère, J. M., & Moutounet, M. (1989b). Effect of pomacecontactandhyperoxidationonthephenoliccompositionandqualityofGrenacheandC hardonnaywines.Am.J.Enol.Vitic.,40,36-42.
40. Cheynier, V., Fulcrand, H., Guyot, S., Oszmianski, J., & Moutounet, M. (1995). Reactions of enzymically generated quinones in relation to browning in grape musts and wines in Lee, C. Y., & Whitaker, J. R. (Eds), Enzymatic browning and its prevention in foods, American Chemical Society, pp. 130-143.
41. Cheynier, V., Fulcrand, H., Sarni, P., & Moutounet, M. (1997a). Reactivity of phenolic compounds in wine: Diversity of mechanisms and resulting products. In Vino analytica scientia. Bordeaux,pp. 143-154.
42. Cheynier, V., Prieur, C., Guyot, S., Rigaud, J., & Moutounet, M. (1997b). The structures of tannins in grapes and wines and their interactions with proteins inWatkins, T. R. (Ed),Wine. Nutritional and therapeutic benefits, American Chemical Society, pp. 81-93.
43. Cheynier, V., Es-Safi, N.-E., & Fulcrand, H. (1999a). Structureandcolourpropertiesofanthocyaninsandrelatedpigments. InternationalCongressonPigmentsinFoodandTechnology.Sevilla(Spain),pp.23-35.
44. Cheynier, V., Souquet, J.-M., Roux, E. L., Guyot, S., & Rigaud, J. (1999b). Size separation of condensed tannins by normal-phase high-performance liquid chromatography in Packer, L.(Ed), Methods Enzymol., Volume 299. Oxidants and antioxidants. Part A., Academic Press, pp. 178-184.
45. Cheynier, V., Duẽnas-Paton, M., Salas, E., Maury, C., Souquet, J.-M., Sarni-Manchado, P., & Fulcrand,H. (2006). Structure and properties of wine pigments and tannins. Am. J. Enol. Vitic., 57,298-305.
46. Clark, A. C., &Scollary,G.R.(2002).Copper(II)-mediatedoxidationof(+)- catechininamodelwhitewinesystem.Aust.J.GrapeWineRes.,8,186-195.
47. Clark, A. C., Prenzler, P. D., & Scollary, G. R. (2003). The role of copper(II) in the bridging reactions of (+)-catechin by glyoxylic acid in a model white wine. J. Agric. Food Chem., 51,6204-6210.
48. Cooper, J. J., & Marshall, A. G. (2001). Electrospray ionisation Fourier transform mass spectrometric analysis of wine. J. Agric. Food Chem., 49, 5710-5718.
49. Cortell, J., & Kennedy, J. A. (2006). Effect of shading on accumulation of flavonoid compounds in(Vitis vinifera L.) Pinot Noir fruit and extraction in a model system. J. Agric. Food Chem., 54,8510-8520.
50. Cortell, J. M., Halbleib, M., Gallagher, A. V., Righetti, T. L., & Kennedy, J. A. (2005). Influence of vine vigor on grape (Vitis vinifera L. Cv. Pinot Noir) and wine proanthocyanidins. J. Agric.Food Chem., 53, 5798-5808.
51. Czochanska,Z.,Foo,L.,&Porter,L.(1979a). Compositionalchangesinlowermolecularweightflavansduringgrapematuration. Phytochemistry,18,1819-1822.
52. Czochanska, Z., Foo, L. Y., Newman, R. H., Porter, L. J., Thomas, W. A., & Jones, W. T. (1979b).Direct proof of a homogeneous polyflavan-3-ol structure for polymeric proanthocyanidins. J.Chem. Soc. Chem. Comm., 8, 375-377.
53. Czochanska, Z., Foo, L. Y., Newman, R. H., & Porter, J. L. (1980). Polymeric proanthocyanidins.Stereochemistry, structural units and molecular weight. J. Chem. Soc. Perkin Trans. I,2278-2286.
54. de Pascual-Teresa, S., Rivas-Gonzalo, J. C., & Santos-Buelga, C. (2000). Prodelphinidins and related flavanols in wine. Int. J. Food Sci. Technol., 35, 33-40.
55. Derdelinckx, G., & Jerumanis, J. (1984). Separation of malt hop proanthocyanidins on Fractogel TSK HW-40 (S). J. Chromatogr., 285, 231-234.
56. Doco, T., Williams, P., & Cheynier, V. (2007). Effect of flash release and pectinolytic enzyme treatments on wine polysaccharide composition. J. Agric. Food Chem., 55, 6643-6649.
57. Downey, M., Harvey, J., & Robinson, S. (2003a). Analysis of tannins in seeds and skins of Shiraz grapes throughout berry development. Austr. J. Grape Wine Res., 9, 15-27.
58. Downey, M., Harvey, J., & Robinson, S. (2003b). Synthesis of flavonols and expression of flavonol synthase genes in the developing grape berries of Shiraz and Chardonnay (Vitis vinifera L.).Austr. J Grape Wine Res., 9, 110-121.
59. Downey, M. O., Harvey, J. S., & Robinson, S. P. (2004). The effect of bunch shading on berry development and flavonoid accumulation in Shiraz grapes. Aust. J. Grape Wine Res., 10, 55-73.
60. Drinkine, J., Glories, Y., & Saucier, C. (2005). (+)catechin-aldehyde condensations: competition between acetaldehyde and glyoxylic acid. J. Agric. Food Chem., 53, 7552-7558.
61. Drinkine, J., Lopes, P., Kennedy, J., Teissedre, P., & Saucier, C. (2007a). Analysis of ethylidenebridged flavan-3-ols in wine. J. Agric. Food Chem., 55, 1109-1116.
62. Drinkine, J., Lopes, P., Kennedy, J., Teissedre, P., & Saucier, C. (2007b). Ethylidene-bridged flavan-3-ols in red wine and correlation with wine age. J. Agric. Food Chem., 55, 6292-6299.
63. Ducasse, M.-A., Souquet, J.-M., Fulcrand, H., & Cheynier, V. (2007). Impact des traitements enzymatiques sur la composition phénoliques des vins rouges. 8th Symposium International d'OEnologie. Bordeaux, France.
64. Duenas, M., Fulcrand, H., & Cheynier, V. (2006a). Formation of anthocyanin-flavanol adducts in model solutions. Anal. Chim. Acta., 563, 15-25.
65. Duenas, M., Salas, E., Cheynier, V., Dangles, O., & Fulcrand, H. (2006b). UV-Visible spectroscopic investigation of the 8-8-methylmethine catechin-malvidin 3-glucoside pigments in aqueous solution : structural transformations and molecular complexation with chlorogenic acid. J.Agric. Food Chem., 54, 189-196.
66. Dufour, C., & Bayonove, C. (1999). Interactions between wine polyphenols and aroma substances.An insight at the molecular level. J. Agric. Food Chem., 47, 678-684.
67. Dufour, C., & Dangles, O. (2005). Flavonoid-serum albumin complexation: determination of binding constants and binding sites by fluorescence spectroscopy. Biochim. Biophys. Acta-General Subjects 1721, 164-173.
68. Dupin, I. V. S., McKinnon, B. M., Ryan, C., Boulay, M., Markides, A. J., Jones, G. P.,Williams, P.J., & Waters, E. J. (2000). Saccharomyces cerevisiae mannoproteins that protect wine from protein haze: theirreleaseduringfermentationandleescontactandaproposalfortheirmechanismof action.J.Agric.FoodChem.,48,3098-3105.
69. Escribano-Bailon, T.,Alvarez-Garcia, M., Rivas-Gonzalo, J. C.,Heredia, F. J., & Santos-Buelga, C.(2001). Color and stability of pigments derived from the acetaldehyde-mediated condensation between malvidin-3-O-glucoside and (+)-catechin. J. Agric. Food Chem., 49, 1213-1217.
70. Es-Safi, N., Fulcrand, H., Cheynier, V., & Moutounet, M. (1999a). Competition between (+)-catechin and (-)-epicatechin in acetaldehyde-induced polymerization of flavanols. J. Agric.Food Chem., 47, 2088-2095.
71. Cheynier, V., & Moutounet, M. (1999b). New polyphenolic compounds with xanthylium skeletons formed through reaction between (+)-catechin and glyoxylic acid. J. Agric. Food Chem., 47, 5211-5217.
72. Es-Safi, N. E., Cheynier, V., & Moutounet, M. (2000). Study of the reactions between (+)-catechin and furfural derivatives in the presence or absence of anthocyanins and their implication in food color change. J. Agric. Food Chem., 48, 5946-5954.
73. Fernandez-Zurbano, P., Ferreira, V., Pena, C., Escudero, A., & Cacho, J. (1999). Effects of maceration time and pectolytic enzymes added during maceration on the phenolic composition of must. J. Food Sci. Technol. Internat., 5, 319-325.
74. Fournand, D., Vicens, A., Sidhoum, L., Souquet, J.-M., Moutounet, M., & Cheynier, V. (2006).Accumulation and extractability of grape skin tannins and anthocyanins at different advanced physiological stages. J. Agric. Food Chem., 54, 7331-7338.
75. Fulcrand, H., Doco, T., Es-Safi, N., Cheynier, V., & Moutounet, M.(1996).Studyoftheacetaldehydeinducedpolymerisationofflavan-3- olsbyliquidchromatographyionspraymassspectrometry.J.Chromatogr.,752,85-91.
76. Fulcrand, H., Remy, S., Souquet, J.-M., Cheynier, V., & Moutounet, M.(1999).Studyofwinetanninoligomersbyon- lineliquidchromatographyelectrosprayionisationmassspectrometry.J.Agric.FoodChem. ,47,1023-1028.
77. Fulcrand, H., Morel-Salmi, C., Poncet-Legrand, C.,Vernhet,A., &Cheynier,V.(2006).Tannins:Fromreactionstocomplexsupramolecularstructures. Austr.J.GrapeWineRes.Adélä?de,Australie,pp.12-17.
78. Gao, L., Girard, B.,Mazza, G., & Reynolds, A. G. (1997). Changes in anthocyanins and color characteristics of Pinot Noir wines during different vinification processes. J. Agric. Food Chem., 45,2003-2008.
79. Gerbaud, V., & Gabas, N. (1997). Influence of wine polysaccharides and polyphenols on the crystallization of potassium hydrogen tartrate. J. Int. Sci. Vigne Vin, 31, 65-83.
80. Guyot, S., Pellerin, P., Brillouet, J., Moutounet, M., &Cheynier,V.(1996a).Inhibitionofb-glucosidase(AmygdalaeDulces)by(+) -catechinoxidationproductsandprocyanidindimers.Biosci.,Biotech.Biochem.,60, 1131-1135.
81. Guyot, S.,Vercauteren,J.,&Cheynier,V.(1996b). Colourlessandyellowdimersresultingfrom(+)- catechinoxidativecouplingcatalysedbygrapepolyphenoloxidase.Phytochemistry,42, 1279-1288.
82. Hagerman, A. E. (1989). Chemistry of tannin-protein complexation in Hemingway, R. W., & Karchesy, J. J. (Eds), Chemistry and significance of condensed tannins, Plenum Press, pp.323-331.
83. Haslam, E. (1980). In vino veritas: oligomeric procyanidins and the ageing of red wines. Phytochemistry,19, 2577-2582.
84. Haslam,E.,&Lilley,T.H.(1988).Naturalastringencyinfoodstuffs. Amolecularinterpretation.Crit.Rev.FoodSci.Nutr.,27,1-40.
85. Haslam, E., Lilley, T. H., Warminski, E., Liao, H., Cai, Y., Martin, R., Gaffney, S. H., Goulding,P. N., & Luck, G. (1992). Polyphenol complexation. A study in molecular recognition. in Ho,C.-T., Lee, C. Y., & Huang, M.-T. (Eds), Phenolic compounds in food and their effects on health, American Chemical Society, pp. 8-50.
86. Hathway, D. E., & Seakins, J. W. T.(1957).Autoxidationofpolyphenols. PartIII.Autoxidationinneutralaqueoussolutionsofflavansrelatedtocatechin.J.Chem. Soc.,300,1562-1566.
87. Hayasaka, Y., & Kennedy, J. A. (2003). Mass spectrometric evidence for the formation of pigmented polymers in red wine. Austr. J. Grape Wine Res., 9, 210-220.
88. Hemingway, R. W., Steynberg, P. J., Steynberg, J. P., & Hatano, T. (1999). NMR studies on the conformation of polyflavanoids and their association with proteins in Argyropoulos, D. S. (Ed),Advances in lignocellulosics characterization, TAPPI Press, pp. 157-178.
89. Hmamouchi, M., Es-Safi, N., Lahrichi, M., Fruchier, A., & Essassi, E. M. (1996). Flavones and flavonols in leaves of some Moroccan Vitis vinifera cultivars. J. Agric. Food Chem., 47,186-192.
90. Jobstl, E., Howse, J. R., Fairclough, J. P. A., & Williamson, M. P.(2006). Noncovalentcrosslinkingofcaseinbyepigallocatechingallatecharacterizedbysinglemo leculeforcemicroscopy.J.Agric.FoodChem.,54,4077-4081.
91. Jurd, L. (1967). Anthocyanidins and related compounds-XI. Catechin-flavylium salt condensation reactions. Tetrahedron, 23, 1057-1064.
92. Jurd, L. (1969). Reviewofpolyphenolcondensationreactionsandtheirpossibleoccurrenceintheagingof wines.Am.J.Enol.Vitic.,20,195-197.
93. Jurd,L.,&Somers,T.C.(1970). Theformationofxanthyliumsaltsfromproanthocyanidins.Phytochemistry,9,419-427.
94. Jurd, L., & Waiss, A. C. (1965). Anthocyanins and related compounds-VI Flavylium saltphloroglucinol condensation product. Tetrahedron, 21, 1471-1483.
95. Kawamoto, H., & Nakatsubo, F. (1997). Effects of environmental factors on two-stage tanninprotein co-precipitation. Phytochemistry, 46, 479-483.
96. Kelm, M. A., Johnson, J. C., Robbins, R. J., Hammerstone, J. F., & Schmitz, H. H. (2006). High-Performance Liquid Chromatography Separation and Purification of Cacao (Theobroma cacao L.) Procyanidins According to Degree of Polymerization Using a Diol Stationary Phase. J.Agric. Food Chem., 54, 1571-1576.
97. Kennedy, J. A., Hayasaka, Y., Vidal, S.,Waters, E. J., & Jones, G. P. (2001). Composition of grape skin proanthocyanidins at different stages of berry development. J. Agric. Food Chem., 49,5348-5355.
98. Kennedy, J. A., Matthews, M. A., & Waterhouse, A. L. (2002). Effect of maturity and vine water status on grape skin and wine flavonoids. Am. J. Enol. Vitic., 53, 268-274.
99. Laborde, B., Moine-Ledoux, V., Richard, T., Saucier, C., Dubourdieu, D., & Monti, J.-P.(2006). PVPP-Polyphenol complexes: A molecular approach. J. Agric. Food Chem., 54,4383-4389.
100. Le Bourvellec, C., Guyot, S., & Renard, C. M. G. C. (2004). Non-covalent interactionbetweenprocyanidinsandapplecellwallmaterial.PartI- Effectofsomeenvironmentalparameters.Biochim.Biophys.Acta,1672,192-202.
101. Le Bourvellec, C., Bouchet, B., & Renard, C. M. G. C. (2005). Non-covalent interaction between procyanidins and apple cell wall material. Part III: Study on model polysaccharides. Biochim.Biophys. Acta, 1725, 10-18.
102. Le Bourvellec, C., Picot, M., & Renard, C. (2006). Size-exclusion chromatography of procyanidins:Comparison between appleandgrapeprocyanidinsandapplicationtothecharacterizationoffractionsofhighd egreesofpolymerization.Anal.Chim.Acta,563,33-43.
103. Lea, A. G. H., & Timberlake, C. F. (1974). The phenolics of ciders.1.Procyanidins. J. Sci. Food Agric., 25, 1537-1545.
104. Lea, A. G. H., Bridle, P., Timberlake, C. F., & Singleton, V. L. (1979). The procyanidins of white grapes and wines. Am. J. Enol. Vitic., 30, 289-300.
105. Lee, C. Y., & Jaworski, A. (1987). Phenolic compounds in white grapes grown in New York. Am.J. Enol. Vitic., 38, 277-281.
106. Lee, C. Y., & Jaworski, A. W. (1990). Identification of some phenolics in white grapes. Am. J.Enol. Vitic., 41, 87-89.
107. Liao, H., Cai, Y., & Haslam, E. (1992). Polyphenol interactions. Anthocyanins: co-pigmentation and colour changes in red wines. J. Sci. Food Agric., 59, 299-305.
108. Luck, G., Liao, H., Murray, N. J., Grimmer, H. R., Warminski, E. E., Willamson, M. P., Lilley, T.H., & Haslam, E. (1994). Polyphenols, astringency and prolin-rich proteins. Phytochemistry,37, 357-371.
109. Malien-Aubert, C., Dangles, O.,&Amiot,M.-J.(2002). Influenceofprocyanidinsonthecolorstabilityofoeninsolutions.J.Agric.FoodChem.,50, 3299-3305.
110. Mané, C. (2007). Phénomènes oxydants et composés phénoliques dans les vins blancs de Champagne: développements méthodologiques pour l'analyse des polymères, Formation Doctorale Sciences des Aliments, Montpellier Supagro, p. 279.
111. Mané, C., Sommerer, N., Yalcin, T., Cheynier, V., Cole, R. B., & Fulcrand, H. (2007a). Assessment of the molecular weight distribution of tannin fractions through MALDI-TOF MS analysis of protein-tannin complexes. Anal. Chem., 79, 2239-2248.
112. Mané, C., Souquet, J.M., Olle, D., Verries, C., Veran, F., Mazerolles, G., Cheynier, V., & Fulcrand,H. (2007b). Optimization of simultaneous flavanol, phenolic acid, and anthocyanin extraction from grapes using an experimental design: Application to the characterization of champagne grape varieties. J. Agric. Food Chem., 55, 7224-7233.
113. Masa, A., Vilanova, M., & Pomar, F. (2007). Varietal differences among the flavonoid profile of white grape cultivars studied by high performance liquid chromatography. J. Chromatogr. A1164, 291-297.
114. Mateus, N., de Pascual-Teresa, S., Rivas-Gonzalo, J., Santos-Buelga, C., & De Freitas, V.(2002). Structural diversity of anthocyanin-derived pigments in port wines. Food Chem., 76,335-342.
115. Mateus, N., Silva, A. M. S., Rivas-Gonzalo, J. C., Santos-Buelga, C., &DeFreitas,V.(2003).Anewclassofblueanthocyanin- derivedpigmentsisolatedfromredwines.J.Agric.FoodChem.,51,1919-1923.
116. Matthews, A., Grbin, P. R., & Jiranek, V.(2006). Asurveyoflacticacidbacteriaforenzymesofinteresttooenology.Austr.J.GrapeWineRes., 12,235-244.
117. Mattivi, F., Guzzon, R., Vrhovsek, U., Stefanini, M., & Velasco, R. (2006). Metabolite Profiling of Grape: Flavonols and Anthocyanins. J. Agric. Food Chem., 54, 7692-7702.
118. Maury, C., Sarni-Manchado, P., Lefebvre, S., Cheynier, V., & Moutonet, M. (2001). Influence of fining with different molecular weight gelatins on proanthocyanidin composition and perception of wines. Am. J. Enol. Vitic., 52, 140-145.
119. Maury, C., Sarni-Manchado, P., Lefebvre, S., Cheynier, V., & Moutounet, M. (2003). Influence of fining with plant proteins on proanthocyanidin composition of red wines. Am. J. Enol. Vitic.,54, 105-111.
120. Mazauric, J.-P., & Salmon, J.-M. (2005). Interactions between yeast lees and wine polyphenols duringsimulationofwineaging:I. Analysisofremnantpolyphenoliccompoundsintheresultingwines.J.Agric.FoodChem.,53, 5647-5653.
121. Mazauric, J.-P., & Salmon, J.-M. (2006). Interactions between yeast lees and wine polyphenols during simulation of wine aging. II. Analysis of desorbed polyphenol compounds from yeast lees. J. Agric. Food Chem., 54, 3876-3881.
122. Mazza, G., & Miniati, E. (1993). Grapes in Mazza, G., & Miniati, E. (Eds), Anthocyanins in fruits,vegetables and grains, CRC Press, pp. 149-199.
123. McManus, J. P., Davis, K. G., Beart, J. E., Galffney, S. H., Lilley, T. H., & Haslam, E. (1985).Polyphenol interactions. Part 1. Introduction; some observations on the reversible complexation of polyphenols with proteins and polysaccharides. J. Chem. Soc. Perkin Trans, II, 1429-1438.
124. Mirabel, M., Glories, Y., Pianet, I., & Dufourc,E.J.(1999a). TowardshighresolutionH-1NMRspectraoftannincolloidalaggregates.J. ChimiePhysiquePhysico-ChimieBiologique,96,1629-1634.
125. Mirabel, M., Saucier, C., Guerra, C., & Glories, T. (1999b). Copigmentation in model wine solutions:Occurrence and relation to wine aging. Am. J. Enol. Vitic., 50, 211-218.
126. Monagas, M., Gómez-Cordovés, C., Bartolomé, B., Laureano, O., & Silva, J. M. R. D. (2003).Monomeric, oligomeric, and polymeric flavan-3-ol composition of wines and grapes from Vitis vinifera L. Cv. Graciano, Tempranillo, and Cabernet Sauvignon. J. Agric. Food Chem., 51,6475-6481.
127. Morel-Salmi, C., Souquet, J. M., Bes, M., & Cheynier, V. (2006). The effect of flash release treatment on phenolic extraction and wine composition. J. Agric. Food Chem.,54, 4270-4276.
128. Murray, N. J., Williamson, M. P., Lilley, T. H., & Haslam, E. (1994). Study of the interaction between salivary proline-rich proteins and a polyphenol by 1H-NMR spectroscopy. Eur. J.Biochem., 219, 923-935.
129. Nagel, C.W., & Wulf, L.W. (1979). Changes in the anthocyanins, flavonoids and hydroxycinnamic acid esters during fermentation and aging of merlot and cabernet sauvignon. Am. J. Enol. Vitic.,30, 111-116.
130. Nakajima, J. J., Tanaka, Y., Yamazaki, M., & Saito, K.(2001).Reactionmechanismfromleucoanthocyanidintoanthocyanin-3-glucoside, akeyreactionforcoloringinanthocyaninbiosynthesis.J.Biol.Chem.,276,25797-25803.
131. Oh, H. I., Hoff, J. E., Armstrong, G. S., & Haff, L. A. (1980). Hydrophobic interactions in tanninprotein complexes. J. Agric. Food Chem., 28, 394-398.
132. Ojeda, H., Andary, C., Kraeva, E., Carbonneau, A., & Deloire, A. (2002). Influence of pre- and post-véraison water deficit on synthesis and concentration of skin phenolic compounds during berry growth of Vitis vinifera cv. Shiraz. Am. J. Enol. Vitic., 53, 261-267.
133. Oszmianski, J., Cheynier, C., & Moutounet, M. (1996). Iron-catalyzed oxidation of (+)-catechin in wine-like model solutions. J. Agric. Food Chem., 44, 1972-1975.
134. Ough, C., &Crowell,E.(1979).Pectic-enzymetreatmentofwhitegrapes: temperature,varietyandskin-contacttimefactors.Am.J.Enol.Vitic.,30,22-27.
135. Ough,C.S.,Noble,A.C.,&Temple,D.(1975).PecticEnzymeEffectsonRedGrapes. Am.J.Enol.Vitic.,26,195-200.
136. Outtrup, H. (1989). Haze active peptides in beer. E.B.C. Congress, pp. 609-616.
137. Pardo, F., Salinas, M. R., Alonso, G. L., Navarro, G., & Huerta, M. D. (1999). Effect of diverse enzyme preparations on the extraction and evolution of phenolic compounds in red wines. Food Chem., 67, 135-142.
138. Pascal, C., Poncet-Legrand, C., Sarni-Manchado, P., Cheynier, V., & Vernhet, A. (2006). Effect of ionic strength, tartaric acid and ethanol on the interactions between flavan-3-ols and salivary proline rich proteins. Macromolecules and Secondary metabolites in Grapevine and Wines.Reims.
139. Pascal, C., Poncet-Legrand, C., Imberty, A., Gautier, C., Sarni-Manchado, P., Cheynier, V., & Vernhet, A. (2007). Interactions between a non glycosylated human proline-rich protein and flavan-3-ols are affected by protein concentration and polyphenol/protein ratio. J. Agric. Food Chem., 55, 4895-4901.
140. Pellerin, P., & Cabanis, J.-C. (1998). Les glucides in Flanzy, C. (Ed), Oenologie, Lavoisier Tec & Doc, pp. 40-92.
141. Pereira, G. E., Gaudillere, J.-P., Pieri, P., Hilbert, G., Maucourt, M., Deborde, C., Moing,A., & Rolin,D.(2006). MicroclimateInfluenceonMineralandMetabolicProfilesofGrapeBerries.J.Agric. FoodChem.,54,6765-6775.
142. Perez-Maldonado, R. A., Norton, B. W., &Kerven,G.L.(1995). Factorsaffectinginvitroformationoftannin-proteincomplexes.J.Sci.FoodAgric.,69, 291-298.
143. Pierpoint, W. S. (1969). o-quinones formed in plant extracts : their reactions with amino acids and peptides. Biochem. J. 112, 609-617.
144. Piretti, M. V., Ghedini, M., & Serrazanetti, G. (1976). Isolation and identification of the polyphenolic and terpenoid constituents of Vitis vinifera. v. Trebbiano variety. Annali di Chimica, 66,429-437.
145. Pissara, J., Mateus, N., Rivas-Gonzalo, J., Santos-Buelga, C., & De Freitas, V. (2003). Reaction between malvidin 3-glucoside and (+)-catechin in model solutions containing different aldehydes. J. Food Sci., 68, 476-481
146. Poncet-Legrand, C., Cartalade, D., Putaux, J.-L., Cheynier, V., & Vernhet, A. (2003). Flavan-3-olaggregationinmodelethanolicsolutions: incidenceofpolyphenolstructure,concentrationethanolcontentandionicstrength. Langmuir,19,10563-10572.
147. Poncet-Legrand, C., Edelmann, A., Putaux, J.-L., Cartalade, D., Sarni-Manchado, P., & Vernhet, A. (2006). Poly(L-proline) interactions with flavan-3-ols units: Influence of the molecular structure and the polyphenol/protein ratio. Food Hydrocolloids, 20, 687-697.
148. Poncet-Legrand, C., Gautier, C., Cheynier, V., & Imberty, A. (2007). Interactionsbetweenflavan-3-olsandpoly(L-proline) studiedbyisothermaltitrationcalorimetry:Effectofthetanninstructure.J.Agric. FoodChem.,55,9235-9240.
149. Price, S. F., Breen, P. J., Vallado, M., & Watson, B. T. (1995). Cluster sun exposure and quercetin in pinot noir grapes and wine. Am. J. Enol. Vitic., 46, 187-194.
150. Prieur,C.,Rigaud,J.,Cheynier,V.,&Moutounet,M.(1994). Oligomericandpolymericprocyanidinsfromgrapeseeds.Phytochemistry,36,781-784.
151. Quideau, S., Jourdes, M., Saucier, C., Glories, Y., Pardon, P., & Baudry, C. (2003). DNA topoisomerase inhibitor acutissimin A and other flavano-ellagitannins in red wine. Angew. Chem. Int.Ed., 42, 6012-6014.
152. Remy, S. (1999). Caractérisation des composés phénoliques polymériques des vins rouges,INAPG, pp. 199.
153. Remy, S., Fulcrand, H., Labarbe, B., Cheynier, V., & Moutounet, M. (2000). First confirmation in red wine of products resulting from direct anthocyanin-tannin reactions. J. Sci. Food Agric., 80,745-751.
154. Remy-Tanneau, S., Guerneve, C. L., Meudec, E., & Cheynier, V. (2003). Characterization of a colorlessanthocyanin-flavan-3- oldimercontainingbothcarbon- carbonandetherinterflavanoidlinkagesbyNMRandmassspectrometries.J.Agric.FoodChem. ,51,3592-3597.
155. Renard, C. M. G. C., Baron, A., Guyot, S., & Drilleau, J. (2001). Interactions between apple cell walls and native apple polyphenols: quantification and some consequences. Int. J. Biol.Macromolecules, 29, 115-125.
156. Ribéreau-Gayon, P. (1964). Lescomposésphé noliquesduraisinetduvinII.Lesflavonosidesetlesanthocyanosides.Ann.Physiol. Vég.,6,211-242.
157. Ribéreau-Gayon, P. (1982). The anthocyanins of grapes and wines in Markakis, P. (Ed), Anthocyanins as food colors, Academic Press, pp. 209-244.
158. Ricardo da Silva, J. M., Bourzeix, M., Cheynier, V., & Moutounet, M. (1991a). Procyanidin composition of Chardonnay, Mauzac and Grenache blanc grapes. Vitis, 30,245-252.
159. Ricardo da Silva, J. M., Cheynier, V., Souquet, J.-M., Moutounet, M., Cabanis, J.-C., & Bourzeix,M. (1991b). Interaction of grape seed procyanidins with various proteins in relation to wine fining. J. Sci. Food Agric., 57, 111-125.
160. Ricardo da Silva,J.M.,Rigaud,J.,Cheynier,V.,Cheminat,A.,&Moutounet,M. (1991c).Procyanidindimersandtrimersfromgrapeseeds.Phytochemistry,30,1259-1264.
161. Ricardo da Silva, J. M., Cheynier, V., Samson, A., & Bourzeix, M. (1993). Effect of pomace contact, carbonic maceration and hyperoxidation on the procyanidin composition of Grenache blanc wines. Am. J. Enol. Vitic., 44, 168-172.
162. Richard-Forget, F., Rouet-Mayer, M.-A., Goupy, P. M., Philippon, J., & Nicolas, J. J. (1992).Oxidation of chlorogenic acid, catechins, and 4-methylcatechol in model solutions by apple polyphenol oxidase. J. Agric. Food Chem., 40, 2114-2122.
163. Rigaud, J., Escribano-Bailon, M. T., Prieur, C., Souquet, J.-M., & Cheynier,V.(1993).Normalphasehigh- performanceliquidchromatographicseparationofprocyanidinsfromcacaobeansandgrap eseeds.J.Chromatogr.A,654,255-260.
164. Riou, V., Vernhet, A., Doco, T.,&Moutounet,M.(2002).Aggregation of grape seed tannins in model-effect of wine polysac charides.Food Hydrocolloids,16,17-23.
165. Rodriguez Montealegre, R., Romero Peces, R., Chacon Vozmediano, J. L., Martinez Gascuena, J., & Garcia Romero, E. (2006). Phenolic compounds inskinsandseedsoftengrapeVitisviniferavarietiesgrowninwarmclimates.J.FoodCompos. Anal.,19,687-693.
166. Rodriguez-Clemente, R., & Correa-Gorospe, I. (1988). Structural,
167. Roggero, J. P., Larice, J. L., Rocheville Divorne, C., Archier, P., & Coen, S. (1988). Composition anthocyanique des cépages.I:Essai de classification par analyse encomposantes principales et par analyse factorielle discriminante.Rev.F.Oenol.,112,41-48.
168. Romeyer, F., Macheix, J. J., & Sapis, J. C. (1986). Changes and importance of oligomeric procyanidins during maturation of grape seeds. Phytochemistry, 25, 219-221.
169. Salas, E., Fulcrand, H.,Meudec,E.,&Cheynier,V.(2003). Reactionsofanthocyaninsandtanninsinmodelsolutions.J.Agric.FoodChem.,51, 7951-7961.
170. Salas, E., Atanasova, V., Poncet-Legrand, C., Meudec, E., Mazauric, J., &Cheynier,V.(2004).Demonstrationoftheoccurrenceofflavanol- anthocyaninadductsinwineandinmodelsolutions.Anal.Chim.Acta,513,325-332.
171. Salas, E., Duẽnas, M., Schwarz, M., Winterhalter, P., Cheynier, V., &Fulcrand,H.(2005). Characterizationofpigmentsfromdifferenthighspeedcountercurrentchromatographywin efractions.J.Agric.FoodChem.,53,4536-4546.
172. Santos-Buelga,C.,Bravo-Haro,S.,&Rivas-Gonzalo,J.(1995).Interactions between catechin and malvidin-3-monoglucoside inmodel solutions.Z.Lebens.-Unter. Forsch.,201.
173. Sarni-Manchado, P., & Cheynier, V. (2002). Study of noncovalent complexation between catechin derivatives and peptide by electrospray ionization-mass spectrometry (ESI-MS). J. Mass Spectrom.,37, 609-616.
174. Sarni-Manchado, P., Deleris, A., Avallone, S., Cheynier, V., & Moutounet, M. (1999). Analysis and characterization of wine condensed tannins precipitated by protein used as fining agent in enology. Am. J. Enol. Vitic., 50, 81-86.
175. Saucier, C., Bourgeaois, G., Vitry, C., Roux, D., &Glories,Y.(1997a). Characterizationof(+)-catechin-acetaldehydepolymers: Amodelforcolloidalstateofwinepolyphenols.J.Agric.FoodChem.,45,1045-1049.
176. Saucier, C., Guerra,C.,Pianet,I.,Laguerre,M.,&Glories,Y.(1997b).(+) catechin-acetaldehydecondensationproductsinrelationtowineageing.Phytochemistry, 46,229-234.
177. Saucier, C., Roux, D., & Glories, Y. O., Symp.(1996). Stabilité collö?dale de polymères catéchiques: influence des polysaccharides in Lonvaud-Funel, Int. Oenol., 5th Meeting; Tec & Doc - Lavoisier:Paris, 1996. (Ed), Oenologie95, Lavoisier, Tec et Doc, pp. 395-400.
178. Sausse, P.,Aguie-Beghin,V.,&Douillard,R.(2003).Effects of epigallocatechin gallate on betacasein adsorption at theair/water interface.Langmuir,19,737-743.
179. Siebert, K.J.,Carrasco,A.,&Lynn,P.Y.(1996).Formationofprotein- polyphenolhazeinbeverages.J.Agric.FoodChem.,44,1997-2005.
180. Simpson,R.F.(1982).Factorsaffectingoxidativebrowningofwhitewine.Vitis,21, 233-239.
181. Singleton, V. L.,&Draper,D.(1964). Thetransferofpolyphenoliccompoundsfromgrapeseedsintowines.Am.J.Enol.Vitic.,15, 34-40.
182. Smith, V. K., Ndou, T. T., & Warner,I.M.(1994). Spectroscopicstudyoftheinteractionofcatechinwitha-,b-andg-cyclodextrins.J. PhysicalChem.,98,8627-8631.
183. Somers, T. C. (1971). The polymeric nature of wine pigments. Phytochemistry, 10, 2175-2186.
184. Somers, T. C., & Pocock, K. F. (1991). Phenolic assessment of white musts: varietal differences in free-run juices and pressings. Vitis, 30, 189-201.
185. Somers, T. C., & Ziemelis, G. (1985). Flavonol haze in white wines. Vitis, 24, 43-50.
186. Souquet, J.-M., Cheynier, V., Brossaud, F., & Moutounet, M. (1996). Polymeric proanthocyanidins from grape skins. Phytochemistry, 43, 509-512.
187. Souquet, J.-M., Labarbe, B.,LeGuernevé,C.,Cheynier,V., &Moutounet,M.(2000).Phenolic composition of grape stems.J.Agric.FoodChem., 48,1076-1080.
188. Souquet, J.-M., Veran, F., Mané, C., & Cheynier, V. (2006). Optimization of extraction conditions on phenolic yields from the different parts of grape clusters - Quantitative distribution of their proanthocyanidins. XXIII International Conference on Polyphenols. Winnipeg,Manitoba,Canada.
189. Spayd, S., Tarara, J., Mee, D., & Ferguson, J. (2002). Separation of Sunlight and Temperature Effects on the Composition of Vitis vinifera cv.MerlotBerries.Am.J.Enol.Vitic.,53,171-182.
190. Stafford, H., & Lester, H. (1984). Flavan-3-ol biosynthesis; the conversion of (+)-dihydroquercetin and flavan-3,4-cis-diol (leucocyanidin) to (+) catechin by reductases extracted from cell suspension cultures of Douglas fir. Plant Physiol., 76, 184-186.
191. Su, C., & Singleton, V. (1969). Identification of three flavan-3-ols from grapes. Phytochemistry, 8,1553-1558.
192. Sun, B. S., Pinto, T., M.C. Leandro, Ricardo-Da-Silva, J. M., & Spranger, M. I. (1999). Transfer of catechins and proanthocyanidins from solid parts of the grape cluster into wine. Am. J. Enol.Vitic., 50, 179-184.
193. Talcott, S., & Lee, J. (2002). Ellagic acid and flavonoid antioxidant content of Muscadine wine and juice. J. Agric. Food Chem., 50, 3186-3192.
194. Tesnière, C., Torregrosa, L., Pradal, M., Souquet, J.-M., Gilles, C., Dos Santos, K., Chatelet, P., & GÜnata, Z. (2006). Effects of genetic manipulation of alcoholdehydrogenaselevelsontheresponsetostressandthesynthesisofsecondarymetab olitesingrapevineleaves.J.Exp.Bot.,57,91-99.
195. Timberlake, C. F., & Bridle, P. (1976). Interactions between anthocyanins, phenolic compounds,and acetaldehyde and their significance in red wines. Am. J. Enol. Vitic., 27, 97-105.
196. Trousdale, E., & Singleton, V. L. (1983). Astilbin and engeletin in grapes and wines. Phytochemistry,22, 619-620.
197. Vasserot, Y., Caillet, S., & Maujean, A. (1997). Study of anthocyanin adsorption by yeast lees.AEffect of some physicochemical parameters. Am. J. Enol. Vitic., 48, 433-437.
198. Vernhet, A., & Moutounet, M. (2002). Fouling of organic microfiltration membranes bywineconstituents:importance, relativeimpactofwinepolysaccharidesandpolyphenolsandincidenceofmembraneproper ties.J.MembraneSci.,201,101-122.
199. Vernhet, A., Bellon-Fontaine, M. N., Brillouet, J.-M., Roesink, E., & Moutounet, M. (1997). Wetting properties of microfiltration membrane: determination by means of the capillary rise technique and incidence on the adsorption of wine polysaccharide and tannins. J. Membrane Sci.128, 163-174.
200. Vernhet, Cartalade, D., & Moutounet, M. (2003). Contribution to the understanding of fouling build-up during microfiltration of wines. J. Membr. Sci.e 211, 357-370.
201. Vernhet, A., Dupré, K., Boulangé L., Cheynier V., Pellerin P., & Moutounet M. (1999a). Composition of tartrate precipitates deposited on stainless steel tanks during the cold stabilization of wines. Part I : white wines. Am. J. Enol. Vitic., 50, 391-397.
202. Vernhet, A., Dupré, K., Boulangé L., Cheynier V., Pellerin P., & Moutounet M. (1999b). Composition of tartrate precipitates deposited on stainless steel tanks during the cold stabilization of wines. Part II: red wines. Am. J. Enol. Vitic., 50, 398-403.
203. Vidal, S., Cartalade, D., Souquet, J., Fulcrand, H., & Cheynier, V. (2002). Changes in proanthocyanidin chain-length in wine-like model solutions. J. Agric Food Chem., 50, 2261-2266.
204. Vidal, S., Francis, L., Guyot, S., Marnet, N., Kwiatkowski, M., Gawel, R., Cheynier, V., & Waters,E.J.(2003).Themouth- feelpropertiesofgrapeandappleproanthocyanidinsinawine-likemedium.J.Sci. FoodAgric.,83,564-573.
205. Waters,E.,Pellerin,P.,&Brillouet,J.(1994).A Saccharomyces mannoprotein that protects wine from protein haze.Carbohydrate Polymers,23,185-191.
206. Waters, E. J., Peng, Z., Pocock, K. F., & Williams, P. J. (1995). Proteins in white wine, I: procyanidin occurrence in soluble protein hazes and its relationships to protein instability. Austr.J. Grape Wine Res., I, 86-93.
207. Waters, E. J., Shirley, N. J., & Williams, P. J. (1996). Nuisance proteins of wine are grape pathogenesis-related proteins. J. Agric. Food Chem., 44, 3-5.
208. Weinges, K., & Muller, O. (1972). Uber die enzymatische oxydative Kupplung der nat rlichen Polyhydroxyflavane. Chemiker Zeitung, 96.
209. Weinges,K.,&Piretti,M.V.(1971).Isolierung des C30H26O12-procyanidins B1 aus Wientrauben.Liebigs. Ann.Chem.,748,218-220.
210. Williamson, M. P., Trevitt, C., & Noble, J. M. (1995). NMR studies of dextran oligomer interactions with model polyphenols. Carbohydrate Research, 266, 229-235.
211. Wulf, L. W., & Nagel, C. W. (1976). Analysis of phenolic acids and flavonoids by high-pressure liquid chromatography. J. Chromatogr., 116, 271-279.
212. Yanagida, A., Kanda, T.,Shoji,T.,Ohnishi-Kameyama,M.,&Nagata,T.(1999) .Fractionationofappleprocyanidinsbysize-exclusionchromatography.J.Chromatogr.A., 855,181-190.
213. Yanagida, A., Kanda, T., Takahashi, T., Kamimura, A., Hamazono, T., & Honda, S. (2000).Fractionation of apple procyanidins according to their degree of polymerization bynormal-phasehigh-performance liquid chromatography.J. Chromatogr.A.,890,251-259.
214. Yokotstuka,K.(1990). Effectofpressdesignandpressingpressuresongrapejuicecomponents.J.Ferment.Bioeng., 70,15-21.
215. Young, D. A., Young, E., Roux, D. G., Brandt, E. V., & Ferreira, D. (1987). Synthesis of condensed tannins.Part19.Phenol oxidative coupling of(+)-catechinand(+)-mesquitol.Conformation of-catechins.J.Chem.Soc.Perkin Trans.I,2345-2351.