메뉴 건너뛰기




Volumn 122, Issue 31, 2000, Pages 7612-7613

Peroxidase activity in heme proteins derived from a designed combinatorial library [11]

Author keywords

[No Author keywords available]

Indexed keywords

HEMOPROTEIN; PEROXIDASE;

EID: 0034625936     PISSN: 00027863     EISSN: None     Source Type: Journal    
DOI: 10.1021/ja001198q     Document Type: Letter
Times cited : (78)

References (28)
  • 3
    • 0002154654 scopus 로고
    • Everse, J., Everse, K. E., Grisham, M. B., Eds.; CRC Press: Boca Raton, FL
    • Dunford, H. B. Peroxidases in Chemistry and Biology; Everse, J., Everse, K. E., Grisham, M. B., Eds.; CRC Press: Boca Raton, FL, 1991; Vol. II, pp 1-24.
    • (1991) Peroxidases in Chemistry and Biology , vol.2 , pp. 1-24
    • Dunford, H.B.1
  • 7
    • 12944253572 scopus 로고    scopus 로고
    • note
    • 8
  • 8
    • 12944301576 scopus 로고
    • Ph.D. Thesis, Princeton University
    • (a) Karntekar, S. Ph.D. Thesis, Princeton University, 1995.
    • (1995)
    • Karntekar, S.1
  • 9
    • 12944315554 scopus 로고    scopus 로고
    • Senior Thesis, Princeton University
    • (b) Mclean, J. Senior Thesis, Princeton University, 1997.
    • (1997)
    • Mclean, J.1
  • 10
    • 12944266063 scopus 로고    scopus 로고
    • Senior Thesis, Princeton University
    • (c) Helmer, K. Senior Thesis, Princeton University, 1997.
    • (1997)
    • Helmer, K.1
  • 12
    • 12944267519 scopus 로고    scopus 로고
    • note
    • 1.8 The sequence of K5 is MGELQHFLEELQKLLQGPDSGHFDNFINHLKKILKGPSGGQLEEMIKQVEDFLQGPRSGHLKNHKDLEELLKR.
  • 13
    • 12944328477 scopus 로고    scopus 로고
    • note
    • 16


* 이 정보는 Elsevier사의 SCOPUS DB에서 KISTI가 분석하여 추출한 것입니다.