메뉴 건너뛰기




Volumn 281, Issue 5378, 1998, Pages 835-838

Positive selection through a motif in the αβ T cell receptor

Author keywords

[No Author keywords available]

Indexed keywords

T LYMPHOCYTE RECEPTOR; T LYMPHOCYTE RECEPTOR ALPHA CHAIN; T LYMPHOCYTE RECEPTOR BETA CHAIN;

EID: 0032493920     PISSN: 00368075     EISSN: None     Source Type: Journal    
DOI: 10.1126/science.281.5378.835     Document Type: Article
Times cited : (103)

References (37)
  • 11
    • 3543020553 scopus 로고    scopus 로고
    • note
    • The α wild-type, β wild-type, αIII, and βIII constructs have been previously described (8). The α wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS (30), with the α-CPM indicated in bold. The β wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAM VKRKNS. Similarly, the corresponding αIII amino acid sequence is CDATLTEKSFETVTVHTEKVNMMSLTVLGLRLLFAKTIAINFLLTVKLFF. The underlined sequences are derived from murine Cδ and consequently, the distal five amino acids (DMNLN) of the α-CPM have been replaced. To permit surface expression of this chimeric α-chain, the αIII construct was paired with the βIII cDNA (8), which encodes the corresponding amino acid sequence CGITSASYQQGVLSATILYLLLLLKSVIYLAIISFSLLRRTSVCGNEKKS. The underlined sequences are derived from murine Cγ1. Although this TCR is encoded by chimeric α and β chains, the functional defects associated with the αIII/βIII TCR are due to the absence of an intact α-CPM (8). cDNAs were excised with Eco RI and Bam and individually cloned into the Sal I and Bam sites of the expression vector pHSE3′ (31).
  • 14
    • 3543016388 scopus 로고    scopus 로고
    • note
    • In contrast to irradiated B6 mice, irradiated B6 athymic nude mice reconstituted with T cell-depleted bone marrow from α-CPM mutant animals failed to generate significant numbers of transgenic T cells. Therefore, the appearance of mutant T cells in the periphery is dependent on the presence of a thymus (12).
  • 21
    • 0030981412 scopus 로고    scopus 로고
    • V. P. Dave et al., EMBO J. 16, 1360 (1997).
    • (1997) EMBO J. , vol.16 , pp. 1360
    • Dave, V.P.1
  • 23
    • 0028985017 scopus 로고
    • K. A. Swan et al., EMBO J. 14, 276 (1995).
    • (1995) EMBO J. , vol.14 , pp. 276
    • Swan, K.A.1
  • 26
    • 13244300652 scopus 로고    scopus 로고
    • R. Amakawa et al., Cell 84, 551 (1996).
    • (1996) Cell , vol.84 , pp. 551
    • Amakawa, R.1
  • 28
    • 0027332254 scopus 로고
    • M. Bigby et al., J. Immunol. 151, 4465 (1993).
    • (1993) J. Immunol. , vol.151 , pp. 4465
    • Bigby, M.1
  • 30
    • 3543022947 scopus 로고    scopus 로고
    • note
    • Single-letter abbreviations for the amino acid residues are as follows: A, Ala; C, Cys; D, Asp; E, Glu; F, Phe; G, Gly; H, His; I, Ile; K, Lys; L, Leu; M, Met; N, Asn; P, Pro; Q, Gln; R, Arg; S. Ser; T, Thr; V, Val; W, Trp; and Y, Tyr.
  • 31
    • 0024438903 scopus 로고
    • H. Pircher et al., EMBO J. 8, 719 (1989).
    • (1989) EMBO J. , vol.8 , pp. 719
    • Pircher, H.1
  • 34
    • 3543021757 scopus 로고    scopus 로고
    • note
    • bm12 mAb 3JP (33) were purified from culture supernatants using protein G Sepharose beads (Pharmacia). Cells were analyzed on a FACScan or a FAC-Star Plus (Becton Dickinson) using the CellQuest software (Becton Dickinson).
  • 36
    • 3543024766 scopus 로고    scopus 로고
    • note
    • -/- mice expressing the wild-type or the α-CPM mutant TCR. Cells were then harvested and stained with Hoechst 33342 (1 μg/ml) followed by staining with CD4 mAb, CD8 mAb, and propidium iodide (2.5 μg/ml) and analyzed by flow cytometry.
  • 37
    • 3542992314 scopus 로고    scopus 로고
    • note
    • -/- (A. Rolink) mice and the pHSE3′ (H. Pircher) vector are gratefully acknowledged. Care of animals was carried out in accordance with the cantonal and federal laws of Switzerland. The Basel Institute for Immunology was founded and is supported by F. Hoffmann-La Roche Ltd., Basel, Switzerland.


* 이 정보는 Elsevier사의 SCOPUS DB에서 KISTI가 분석하여 추출한 것입니다.