HIV-1 entry cofactor: Functional cDNA cloning of a seven-transmembrane, G protein-coupled receptor

Science

Volumn 272, Issue 5263, 1996, Pages 872-877

  Feng, Yu ^a   Broder, Christopher C ^a   Kennedy, Paul E ^a   Berger, Edward A ^a  

^a NATIONAL INSTITUTE OF ALLERGY AND INFECTIOUS DISEASES   (United States)

Author keywords

[No Author keywords available]

Indexed keywords

COMPLEMENTARY DNA; GUANINE NUCLEOTIDE BINDING PROTEIN; VIRUS FUSION PROTEIN;

ARTICLE; CELL FUSION; HUMAN IMMUNODEFICIENCY VIRUS 1; MOLECULAR CLONING; NONHUMAN; PRIORITY JOURNAL; T LYMPHOCYTE; VIRUS CELL INTERACTION;

HUMAN IMMUNODEFICIENCY VIRUS; HUMAN IMMUNODEFICIENCY VIRUS 1;

EID: 0030002637     PISSN: 00368075     EISSN: None     Source Type: Journal    
DOI: 10.1126/science.272.5263.872     Document Type: Article

References (52)

1. P. J. Maddon et al., Cell 47, 333 (1986).
2. P. A. Ashorn, E. A. Berger, B. Moss, J. Virol. 64, 2149 (1990).
3. P. R. Clapham, D. Blanc, R. A. Weiss, Virology 181, 703 (1991).
4. D. B. Weiner, K. Huebner, W. V. Williams, M. I. Greene, Pathobiology 59, 361 (1991).
5. T. Dragic, P. Charneau, F. Clavel, M. Alizon, J. Virol. 66, 4794 (1992).
6. C. C. Broder, D. S. Dimitrov, R. Blumenthal, E. A. Berger, Virology 193, 483 (1993).
7. R. D. Harrington and A. P. Geballe, J. Virol. 67, 5939 (1993).
8. D. Ramarli et al., AIDS Res. Hum. Retroviruses 9, 1269 (1993).
9. T. Dragic and M. Alizon, J. Virol. 67, 2355 (1993).
10. T, Dragic, L. Picard, M. Alizon, ibid. 69, 1013 (1995).
11. B. Chesebro, R. Buller, J. Portis, K. Wehrly, ibid. 64, 215 (1990).
12. O. Nussbaum, C. C. Broder, E. A. Berger, ibid. 68, 5411 (1994).
13. E. A. Berger, C. C. Broder, G. Alkhatib, Y. Feng, Keystone Symposium: Cell Biology of Virus Entry, Replication and Pathogenesis, abstract 002, 8 (1996).
14. Y. Feng, C. C. Broder, P. E. Kennedy, E. A. Berger, Keystone Symposium: Immunopathogenesis of HIV Infection, abstract 116, 21 (1996).
15. 5 of each cell type per well) and incubated 3 hours at 37°C. β-Gal was detected by in situ staining with X-Gal. Because more stained cells were consistently observed with the total library compared to the single plasmid control, the library was subdivided into 1000 fractions (-4000 plasmids each), and pools of the fractions were screened in a similar fashion until a single positive fraction was identified. This fraction was further subdivided into 1000 subfractions (∼4 plasmids each) and screened in the same way. A positive subfraction was identified and plated onto agar. and individual colonies were picked and assayed. A single positive clone was identified (designated pcDNA3-fusin).
16. There are five potential open reading frames in the cDNA sequence; the longest one encoding fusin starts with the first ATG, which has a surrounding sequence consistent with efficient translation initiation in vertebrate cells. To rule out the possibility that the functional activities might be encoded by the other open reading frames, we subcloned into pcDNAS a cDNA fragment containing only the remaining four downstream open reading frames. Unlike the full-length cDNA, the truncated fragment did not allow CD4-expressing NIH 3T3 cells to undergo fusion.
17. H. Herzog, Y. J. Hort, J. Shine, L. A. Selbie, DNA Cell Biol. 12, 465 (1993).
18. B. Federsppiel et al., Genomics 16, 707 (1993).
19. E. E. Jazin et al., Regul. Pept. 47, 247 (1993).
20. H. Nomura, B. W. Nielsen, K. Matsushima, Int. Immunol. 5, 1239 (1993).
21. M. Loetscher et al., J. Biol. Chem. 269, 232 (1994).
22. Compared to the nucleotide sequence reported for the cDNA (21), there is one difference in the 3′ untranslated region: whereas that sequence has eight consecutive T residues beginning at nucleotide 1076. the fusin sequence has seven.
23. Plasmid pcDNAS-fusin was digested with Xho I and blunt-ended with the Klenow fragment of E. coli DNA polymerase. The fusin cDNA insert was excised by digestion with Eco Rl and ligated into Stu I-Eco Rl-digested pSC59 (24). The resulting plasmid, designated pYF1-fusin, was used to generate vaccinia recombinant vCBYF1-fusin.
24. S. Chakrabarti and B. Moss, National Institute of Allergy and Infectious Diseases, personal communication.
25. P. L. Earl, N. Cooper, B. Moss, in Current Protocols in Molecular Biology, vol.2, suppl. 15, F. M. Ausubel et al., Eds. (Wiley, New York, 1991), p. 16.15.1.
26. 2-terminus of fusin (MEGISIYTSDNY-TEEMGSGDYDSMKEPCFREENANFNK; abbreviations for the amino acid residues are as follows: A, Ala; C, Cys; D, Asp; E, Glu; F, Phe; G, Gly; H, His; I, Ile; K, Lys; L, Leu; M, Met; N, Asn; P, Pro; Q, Gln; R, Arg; S, Ser; T, Thr; V, Val; W, Trp; and Y, Tyr) was synthesized by standard FMOC chemistry, purified by reversed-phase high-performance liquid chromatography (HPLC), and analyzed by analytical HPLC, mass spectrometry, and amino acid sequencing. The purified peptide was conjugated to keyhole limpet hemocyanin by means of the Cys residue with the use of m-maleimidobenzoyl-N-hydroxysuccinimide ester (108 peptides per carrier molecule). New Zealand White rabbits were immunized with 200 μg of conjugate emulsified in RiBi adjuvant (RiBi, Hamilton, MT) three times at 28-day intervals For preparation of purified immunoglobulin G, the serum was subjected to affinity chromatography on protein G sepharose.
27. T. M. Richardson et al., J. Virol. 70, 753 (1996).
28. + transformant of Mv 1 Lu (also containing the neomycin resistance gene) (3) was transfected with pZeoSV-fusin (with the use of DOTAP; Boeringer Mannheim); as a negative control, a monolayer of the same cells was transfected with pZeoSV-LacZ (Invitrogen) containing the lacZ gene linked to the SV40 promoter plus the Zeocin resistance gene. After 24 hours, the cells were washed and cultured in Dulbecco's modified Eagle's medium with 10% fetal bovine serum plus antibiotics (during the first 2 days with 1 mg/ml of G418 alone; subsequently, with G418 plus 1 mg/ml of zeocin). Colonies resistant to both antibiotics were picked, amplified, and screened for Env-dependent fusion permissiveness in the vaccinia assay system (with the use of luciferase as the reporter).
29. Y. Feng et al., data not shown.
30. A. Valentin, J. Albert, E. M. Fenyö, B. Asjö, J. Virol. 68, 6684 (1994).
31. V. Planelles, Q.-X. Li, I. S. Y. Chen, in Human Retroviruses, B. R. Cullen, Ed, (Oxford Univ. Press, New York, 1993), p. 17.
32. F. Miedema et al., Immunol. Rev. 140, 35 (1994).
33. R. I. Connor and D. D. Ho, AIDS Res. Hum. Retroviruses 10, 321 (1994).
34. C. C. Broder and E. A. Berger, Proc. Natl. Acad. Sci. USA 92, 9004 (1995).
35. G. Alkhatib, C. C. Broder, E. A. Berger. J. Virol., in press.
36. S. Koenig et al., Proc. Natl. Acad. Sci. U.S.A 86, 2443 (1989).
37. J. A. Hoxie et al. J. Virol. 62, 2557 (1988).
38. A. McKnight, P. R. Clapham, R. A. Weiss, Virology 201, 8 (1994).
39. P. M. Murphy, Annu. Rev. Immunol. 12, 593 (1994).
40. D. R. Cundell, N. P. Gerard, C. Gerard, I. Idanpaan-Heikkila, E. I. Tuomanen, Nature 377, 435 (1995).
41. F. P. Gillespie et al., Mol. Cell. Biol. 13, 2952 (1993).
42. N. Killeen, S. Sawada, D. R, Littman, EMBO J. 12, 1547 (1993).
43. Z. Hanna, C. Simard, A. Laperriere, P. Jolicoeur, Mol. Cell. Biol. 14, 1084 (1994).
44. B. W. Snyder et al., Mol Reprod. Dev. 40, 419 (1995).
45. C. S. Dunn et al., J. Gen. Virol. 76, 1327 (1995).
46. D. Trono, Clin. Lab. Med. 14, 203 (1994).
47. S. Cho, T. J. Kindt, T.-M. Zhao, S. Sawasdikosol, B. F. Hague, AIDS Res. Hum. Retroviruses 11, 1487 (1995).
48. F. Cocchi et al., Science 270, 1811 (1995).
49. T. R. Fuerst, E. G. Niles, F. W. Studier, B. Moss, Proc. Natl, Acad. Sci. U.S.A. 83, 8122 (1986).
50. R. A. Morgan, National Center for Human Genome Research, personal communication.
51. W. A. Alexander, B. Moss, T. R. Fuerst, J. Virol. 66, 2934 (1992).
52. + transformant of Mv 1 Lu; to M. Garfield, J. Lukszo, and J. Coligan, Laboratory of Molecular Structure, NIAID, for synthetic peptide synthesis, purification, and coupling; and to J. Sisler, Laboratory of Viral Diseases, NIAID, for oligonucleotide synthesis and assistance with DNA sequencing. We thank P. Murphy, NIAID, and B. Moss, NIAID, for helpful discussions and comments on the manuscript.