메뉴 건너뛰기




Volumn 273, Issue 5280, 1996, Pages 1392-1395

Crystal structure of the Aequorea victoria green fluorescent protein

Author keywords

[No Author keywords available]

Indexed keywords

PROTEIN;

EID: 0029847806     PISSN: 00368075     EISSN: None     Source Type: Journal    
DOI: 10.1126/science.273.5280.1392     Document Type: Article
Times cited : (2037)

References (43)
  • 1
    • 34548576414 scopus 로고
    • O. Shimomura and F. H. Johnson, J. Cell. Comp, Physiol. 59, 223 (1962); J, G. Morin and J. W. Hastings, J. Cell. Physiol. 77, 313 (1971); H. Morise, O. Shimomura, F. H. Johnson, J. Winant, J. Biochem. 13, 2656 (1974); W, W. Ward, Photochem. Photobiol. Rev. 4, 1 (1979).
    • (1962) J. Cell. Comp, Physiol. , vol.59 , pp. 223
    • Shimomura, O.1    Johnson, F.H.2
  • 2
    • 0015076612 scopus 로고
    • O. Shimomura and F. H. Johnson, J. Cell. Comp, Physiol. 59, 223 (1962); J, G. Morin and J. W. Hastings, J. Cell. Physiol. 77, 313 (1971); H. Morise, O. Shimomura, F. H. Johnson, J. Winant, J. Biochem. 13, 2656 (1974); W, W. Ward, Photochem. Photobiol. Rev. 4, 1 (1979).
    • (1971) J. Cell. Physiol. , vol.77 , pp. 313
    • Morin, J.G.1    Hastings, J.W.2
  • 3
    • 0016156057 scopus 로고
    • O. Shimomura and F. H. Johnson, J. Cell. Comp, Physiol. 59, 223 (1962); J, G. Morin and J. W. Hastings, J. Cell. Physiol. 77, 313 (1971); H. Morise, O. Shimomura, F. H. Johnson, J. Winant, J. Biochem. 13, 2656 (1974); W, W. Ward, Photochem. Photobiol. Rev. 4, 1 (1979).
    • (1974) J. Biochem. , vol.13 , pp. 2656
    • Morise, H.1    Shimomura, O.2    Johnson, F.H.3    Winant, J.4
  • 4
    • 34548576414 scopus 로고
    • O. Shimomura and F. H. Johnson, J. Cell. Comp, Physiol. 59, 223 (1962); J, G. Morin and J. W. Hastings, J. Cell. Physiol. 77, 313 (1971); H. Morise, O. Shimomura, F. H. Johnson, J. Winant, J. Biochem. 13, 2656 (1974); W, W. Ward, Photochem. Photobiol. Rev. 4, 1 (1979).
    • (1979) Photochem. Photobiol. Rev. , vol.4 , pp. 1
    • Ward, W.W.1
  • 8
    • 0029134629 scopus 로고
    • D. C. Prasher, Trends Genet. 11, 320 (1995); M. Chalfie, Photochem. Photobiol. 62, 651 (1995).
    • (1995) Trends Genet. , vol.11 , pp. 320
    • Prasher, D.C.1
  • 9
  • 10
    • 0002870111 scopus 로고
    • M. A. DeLuca and W. D. McElroy, Eds. Academic Press, New York
    • W. W. Ward, in Bioluminescence and Chemiluminescence, M. A. DeLuca and W. D. McElroy, Eds. (Academic Press, New York, 1981), pp. 235-242; -and S. H. Bokman, Biochemistry 21, 4535 (1982); W. W. Ward et al, Photochem. Photobiol. 35, 803 (1982).
    • (1981) Bioluminescence and Chemiluminescence , pp. 235-242
    • Ward, W.W.1
  • 11
    • 0020482348 scopus 로고
    • W. W. Ward, in Bioluminescence and Chemiluminescence, M. A. DeLuca and W. D. McElroy, Eds. (Academic Press, New York, 1981), pp. 235-242; -and S. H. Bokman, Biochemistry 21, 4535 (1982); W. W. Ward et al, Photochem. Photobiol. 35, 803 (1982).
    • (1982) Biochemistry , vol.21 , pp. 4535
    • Bokman, S.H.1
  • 12
    • 84989716053 scopus 로고
    • W. W. Ward, in Bioluminescence and Chemiluminescence, M. A. DeLuca and W. D. McElroy, Eds. (Academic Press, New York, 1981), pp. 235-242; -and S. H. Bokman, Biochemistry 21, 4535 (1982); W. W. Ward et al, Photochem. Photobiol. 35, 803 (1982).
    • (1982) Photochem. Photobiol. , vol.35 , pp. 803
    • Ward, W.W.1
  • 15
    • 9544234893 scopus 로고    scopus 로고
    • Abbreviations for the amino acid residues are as follows; A, Ala; C, Cys; D, Asp; E, Glu; F, Phe; G, Gly; H, His; I, lle; K, Lys; L, Leu; M, Met; N, Asn; P, Pro; Q, Gln; R, Arg; S, Ser; T, Thr; V, Val; W, Trp; and Y, Tyr
    • Abbreviations for the amino acid residues are as follows; A, Ala; C, Cys; D, Asp; E, Glu; F, Phe; G, Gly; H, His; I, lle; K, Lys; L, Leu; M, Met; N, Asn; P, Pro; Q, Gln; R, Arg; S, Ser; T, Thr; V, Val; W, Trp; and Y, Tyr.
  • 17
    • 9544256076 scopus 로고
    • 1 with a = 51.8, b = 62.8, C = 70.7 Å, Z = 4. Two crystal forms of wild-type GFP, unrelated to the present form, have been described by M. A. Perrozo, K. B. Ward, R. B. Thompson, and W. W. Ward [J. Biol. Chem. 203, 7713 (1988)].
    • (1988) J. Biol. Chem. , vol.203 , pp. 7713
    • Perrozo, M.A.1    Ward, K.B.2    Thompson, R.B.3    Ward, W.W.4
  • 20
    • 0015222647 scopus 로고
    • B. Lee and F. M. Richards, J. Mol. Biol. 55, 379 (1971). The atomic radii were those of Lee and Richards, calculated by use of the program MS with a probe radius of 1.4 Å. [M. L. Connolly, Science 221, 709 (1983)].
    • (1971) J. Mol. Biol. , vol.55 , pp. 379
    • Lee, B.1    Richards, F.M.2
  • 21
    • 0021107965 scopus 로고
    • B. Lee and F. M. Richards, J. Mol. Biol. 55, 379 (1971). The atomic radii were those of Lee and Richards, calculated by use of the program MS with a probe radius of 1.4 Å. [M. L. Connolly, Science 221, 709 (1983)].
    • (1983) Science , vol.221 , pp. 709
    • Connolly, M.L.1
  • 23
    • 0026567907 scopus 로고
    • S. J. Hubbard, K.-H. Gross, P. Argos, Protein Eng. 7, 613 (1994); A. E. Eriksson et al., Science 255, 178 (1992).
    • (1992) Science , vol.255 , pp. 178
    • Eriksson, A.E.1
  • 25
    • 9544239760 scopus 로고    scopus 로고
    • note
    • 48.
  • 26
    • 85088549439 scopus 로고    scopus 로고
    • note
    • 2H and the finite resolution of the Hewlett-Packard 5989B electrospray mass spectrometer used to make these measurements do not permit the individual peaks to be resolved, but instead yield an average mass peak with a full width at half maximum of 55 daltons. The molecular sizes shown include the His-tag, which has the sequence MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPPAEF (9, 10).
  • 33
    • 0002452464 scopus 로고
    • L. Sawyer, N. Issacs, S. Bailey, Eds. Science and Engineering Research Council, Daresbury Laboratory, Warrington, UK
    • Z. Otwinowski, in Proceedings of the CCP4 Study Weekend: Data Collection and Processing, L. Sawyer, N. Issacs, S. Bailey, Eds. (Science and Engineering Research Council, Daresbury Laboratory, Warrington, UK, 1991), pp. 56-62; W. Minor, XDISPLAYF (Purdue University, West Lafayette, IN, 1993).
    • (1991) Proceedings of the CCP4 Study Weekend: Data Collection and Processing , pp. 56-62
    • Otwinowski, Z.1
  • 34
    • 0005839617 scopus 로고
    • Purdue University, West Lafayette, IN
    • Z. Otwinowski, in Proceedings of the CCP4 Study Weekend: Data Collection and Processing, L. Sawyer, N. Issacs, S. Bailey, Eds. (Science and Engineering Research Council, Daresbury Laboratory, Warrington, UK, 1991), pp. 56-62; W. Minor, XDISPLAYF (Purdue University, West Lafayette, IN, 1993).
    • (1993) XDISPLAYF
    • Minor, W.1
  • 37
    • 0013507769 scopus 로고
    • Science and Engineering Research Council, Daresbury Laboratory, Warrington, UK
    • CCP4: A Suite of Programs for Protein Crystallography (Science and Engineering Research Council, Daresbury Laboratory, Warrington, UK, 1979).
    • (1979) CCP4: A Suite of Programs for Protein Crystallography
  • 39
    • 0001797984 scopus 로고
    • D. Sayre, Ed. Oxford Univ. Press, Oxford
    • T. A. Jones, J.-Y. Zou, S. W. Cowan, M. Kjelgaard, Acta Crystallogr. Sect. A 47, 110 (1991); T. A. Jones, in Computational Crystallography, D. Sayre, Ed. (Oxford Univ. Press, Oxford, 1982), pp. 303-317.
    • (1982) Computational Crystallography , pp. 303-317
    • Jones, T.A.1
  • 43
    • 9544257663 scopus 로고    scopus 로고
    • note
    • We thank T. Ross for initial crystallization of GFP; M. Sagermann for help with the CCP4 package for crystallographic computing; and M. Elsliger, C. Ogata, and R. Brennan for help with data collection. Facilities at the University of Oregon and beamline X4A at the Brookhaven National Laboratory are supported in part by the Howard Hughes Medical Institute and a grant from the National Science Foundation (MCB 9418479) to S.J.R. M.O. gratefully acknowledges the Swedish Natural Science Research Council for a postdoctoral fellowship.


* 이 정보는 Elsevier사의 SCOPUS DB에서 KISTI가 분석하여 추출한 것입니다.